Jiangsu Biostronger Technology Co.,Ltd

 

HGH, Peptides, IGF-1 LR3, EGF, VEGF, Steroids And SARMs powder, Etc.

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home Products

increase human growth hormone

I'm Online Chat Now
Just completed an order with Peter and his service is A+++. I have posted it elsewhere on the board. I did a gh serum test with his gh and it comes back more 30, crazy high score for 10iu.

—— Ricky Rodrig from USA

Was and am VERY, VERY impressed with Peter. Superb communication and overall customer service!! A+++++. will definitely be doing business with you.

—— Trevor Maki from UK

increase human growth hormone

(56)
buy High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation online manufacturer

High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation

Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSE... Read More Get Best Price
2018-12-19 09:58:01
buy HGH High Pure Human Growth Hormone Cas NO 12629-01-5 For Muscle Building online manufacturer

HGH High Pure Human Growth Hormone Cas NO 12629-01-5 For Muscle Building

High Pure Human Growth Hormone Cas NO 12629-01-5 Muscle Building Cas No. 12629-01-5 Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: ... Read More Get Best Price
2019-09-02 15:38:37
buy Bodybuilding Labeled Strongtropin HGH Human Growth Hormone For Bodybuilding Functions 12629 01 5 online manufacturer

Bodybuilding Labeled Strongtropin HGH Human Growth Hormone For Bodybuilding Functions 12629 01 5

Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSE... Read More Get Best Price
2018-12-19 09:58:01
buy Muscle Growth Human Growth Hormone 12629-01-5 For Bodybuilding Functions online manufacturer

Muscle Growth Human Growth Hormone 12629-01-5 For Bodybuilding Functions

Muscle Growth Human Growth Hormone 12629-01-5 For Bodybuilding Functions Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White ... Read More Get Best Price
2018-12-19 09:58:01
buy Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5 online manufacturer

Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5

Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5 Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White ... Read More Get Best Price
2018-12-19 13:43:21
buy Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass online manufacturer

Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass

Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSES... Read More Get Best Price
2018-12-19 09:58:01
buy Ipamorelin Peptides HGH Human Growth Hormone CAS 170851 70 4 Growth Hormones For Adults online manufacturer

Ipamorelin Peptides HGH Human Growth Hormone CAS 170851 70 4 Growth Hormones For Adults

Cas No. 170851-70-4 Synonyms: Ipamorelin Molecular Formula: C38H49N9O5 MW: 711.85 Sequence: H-Aib-His-D-2-Nal-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Ipamorelin, a pentapeptide ... Read More Get Best Price
2018-12-19 09:58:01
buy CAS 158861 67 7 HGH Human Growth Hormone Peptides GHRP-2 Body Building online manufacturer

CAS 158861 67 7 HGH Human Growth Hormone Peptides GHRP-2 Body Building

Cas No. 158861-67-7 Synonyms: GHRP-2 Acetate Molecular Formula: C45H55N9O6 MW: 817.97 Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Chemotherapy is ... Read More Get Best Price
2018-12-19 13:43:39
buy CAS No 12629-01-5 Top Pure HGH Human Growth Hormone  Anti Aging Growth Hormone online manufacturer

CAS No 12629-01-5 Top Pure HGH Human Growth Hormone Anti Aging Growth Hormone

Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSE... Read More Get Best Price
2018-12-19 09:58:01
buy CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain online manufacturer

CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain

Cas No. 86168-78-7 Synonyms: Sermorelin Acetate Molecular Formula: C149H246N44O42S MW: 3357.88 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp... Read More Get Best Price
2018-12-19 13:43:45
Page 1 of 6|< 1 2 3 4 5 6 >|