Jiangsu Biostronger Technology Co.,Ltd

HGH, Peptides, IGF-1 LR3, EGF, VEGF, Steroids And SARMs powder, Etc.

Sales & Support
Request A Quote - Email

Select Language

English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote

: All Categories Synthetic Growth Hormone HGH Human Growth Hormone IGF Growth Hormone EGF Epidermal Growth Factor Cosmetic Peptides Weight Loss Growth Hormone Follistatin Myostatin Muscle Building Steroids Selective Androgen Receptor Modulators Bodybuilding Hormone Supplements Anti Estrogen Supplements Nootropic Supplements

Home Products

human growth hormone hgh

All Products

Synthetic Growth Hormone (29)

HGH Human Growth Hormone (14)

IGF Growth Hormone (10)

EGF Epidermal Growth Factor (15)

Cosmetic Peptides (12)

Weight Loss Growth Hormone (10)

Follistatin Myostatin (10)

Muscle Building Steroids (41)

Selective Androgen Receptor Modulators (12)

Bodybuilding Hormone Supplements (27)

Anti Estrogen Supplements (10)

Nootropic Supplements (10)

I'm Online Chat Now

Just completed an order with Peter and his service is A+++. I have posted it elsewhere on the board. I did a gh serum test with his gh and it comes back more 30, crazy high score for 10iu.

—— Ricky Rodrig from USA

Was and am VERY, VERY impressed with Peter. Superb communication and overall customer service!! A+++++. will definitely be doing business with you.

—— Trevor Maki from UK

human growth hormone hgh

(61)

CAS 66004-57-7 HGH Human Growth Hormone Fragment 176-91 For Bodybuilding and Fat Loss
Contact Now

Cas No. 66004-57-7 Synonyms: HGH FRAG 176-191,fragment 176 Molecular Formula: C78H125N23O23S2 MW: 1817.1 Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Purity: >98% Bacterial ... Read More Get Best Price

2018-12-19 09:58:01

HGH 176-191 Human Growth Hormone Products Muscle Building Peptides CAS 66004 57 7
Contact Now

2018-12-19 09:48:03

High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation
Contact Now

Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSE... Read More Get Best Price

2018-12-19 09:58:01

CAS No 12629-01-5 Top Pure HGH Human Growth Hormone Anti Aging Growth Hormone
Contact Now

Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSE... Read More Get Best Price

2018-12-19 09:58:01

Bodybuilding Labeled Strongtropin HGH Human Growth Hormone For Bodybuilding Functions 12629 01 5
Contact Now

2018-12-19 09:58:01

Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass
Contact Now

Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSES... Read More Get Best Price

2018-12-19 09:58:01

Ipamorelin Peptides HGH Human Growth Hormone CAS 170851 70 4 Growth Hormones For Adults
Contact Now

Cas No. 170851-70-4 Synonyms: Ipamorelin Molecular Formula: C38H49N9O5 MW: 711.85 Sequence: H-Aib-His-D-2-Nal-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Ipamorelin, a pentapeptide ... Read More Get Best Price

2018-12-19 09:58:01

MGF Mechano Growth Factor Peptide Human Growth Hormone Bodybuilding Growth Hormone
Contact Now

Cas No. N/A Synonyms: MGF (Mechano Growth Factor) Molecular Formula: C121H200N42O39 MW: 2867.14 Sequence: H-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 ... Read More Get Best Price

2018-12-19 09:58:01

Bodybuilding HGH Human Growth Hormone GHRP-6 Muscle Building Peptides CAS 87616-84-0
Contact Now

Cas No. 87616-84-0 Synonyms: GHRP-6 Acetate Molecular Formula: C46H56N12O6 MW: 873.01 Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: GHRP-6, a peptide with ... Read More Get Best Price

2018-12-19 09:58:01

Skin Tanning Melanotan-II Legal Human Growth Hormone Peptide CAS NO 121062 08 6
Contact Now

Cas No. 121062-08-6 Synonyms: Melanotan-II Molecular Formula: C50H69N15O9 MW: 1024.18 Sequence: Ac-Nle-cyclo(-beta-Asp-His-D-Phe-Arg-Trp-epsilon-Lys-NH2) Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction... Read More Get Best Price

2018-12-19 09:55:49