Jiangsu Biostronger Technology Co.,Ltd

HGH, Peptides, IGF-1 LR3, EGF, VEGF, Steroids And SARMs powder, Etc.

Sales & Support
Request A Quote - Email

Select Language

English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote

: All Categories Synthetic Growth Hormone HGH Human Growth Hormone IGF Growth Hormone EGF Epidermal Growth Factor Cosmetic Peptides Weight Loss Growth Hormone Follistatin Myostatin Muscle Building Steroids Selective Androgen Receptor Modulators Bodybuilding Hormone Supplements Anti Estrogen Supplements Nootropic Supplements

Home Products

synthetic human growth hormone

All Products

Synthetic Growth Hormone (29)

HGH Human Growth Hormone (14)

IGF Growth Hormone (10)

EGF Epidermal Growth Factor (15)

Cosmetic Peptides (12)

Weight Loss Growth Hormone (10)

Follistatin Myostatin (10)

Muscle Building Steroids (41)

Selective Androgen Receptor Modulators (12)

Bodybuilding Hormone Supplements (27)

Anti Estrogen Supplements (10)

Nootropic Supplements (10)

I'm Online Chat Now

Just completed an order with Peter and his service is A+++. I have posted it elsewhere on the board. I did a gh serum test with his gh and it comes back more 30, crazy high score for 10iu.

—— Ricky Rodrig from USA

Was and am VERY, VERY impressed with Peter. Superb communication and overall customer service!! A+++++. will definitely be doing business with you.

—— Trevor Maki from UK

synthetic human growth hormone

(44)

HGH 176-191 Human Growth Hormone Products Muscle Building Peptides CAS 66004 57 7
Contact Now

Cas No. 66004-57-7 Synonyms: HGH FRAG 176-191,fragment 176 Molecular Formula: C78H125N23O23S2 MW: 1817.1 Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Purity: >98% Bacterial ... Read More Get Best Price

2018-12-19 09:48:03

Muscle Mass Peptide Synthetic Human Growth Hormone CJC-1295 with DAC CAS 863288-34-0
Contact Now

Cas No. 863288-34-0 Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC Molecular Formula: C152H252N44O42 MW: 3367.97 Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys... Read More Get Best Price

2018-12-19 09:48:03

Skin Tanning Melanotan-II Legal Human Growth Hormone Peptide CAS NO 121062 08 6
Contact Now

Cas No. 121062-08-6 Synonyms: Melanotan-II Molecular Formula: C50H69N15O9 MW: 1024.18 Sequence: Ac-Nle-cyclo(-beta-Asp-His-D-Phe-Arg-Trp-epsilon-Lys-NH2) Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction... Read More Get Best Price

2018-12-19 09:55:49

GHRP-6 Muscle Building Injectable Human Growth Hormone Peptide CAS 87616-84-0 Bodybuilding
Contact Now

Cas No. 87616-84-0 Synonyms: GHRP-6 Acetate Molecular Formula: C46H56N12O6 MW: 873.01 Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: GHRP-6, a peptide with ... Read More Get Best Price

2018-12-19 09:48:03

High Pure Muscle Building Protein Human Growth Hormone 12629-01-5 Growth Hormone Supplementation
Contact Now

Cas No. 12629-01-5 Size: 10iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSE... Read More Get Best Price

2018-12-19 09:58:01

CAS No 12629-01-5 Top Pure HGH Human Growth Hormone Anti Aging Growth Hormone
Contact Now

Cas No. 12629-01-5 Size: 15iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSE... Read More Get Best Price

2018-12-19 09:58:01

Bodybuilding Releasing Peptides Synthetic Growth Hormone Tesamorelin CAS 218949-48-5
Contact Now

Cas No. 218949-48-5 Synonyms: Tesamorelin Molecular Formula: C211H366N72O67S1 MW: 5135.89 Sequence: Purity: >98% Bacterial Endotoxins: < 5EU/mg Description: Tesamorelin, (formerly known as TH9507), is a type of ... Read More Get Best Price

2018-12-19 09:48:03

Sermorelin Acetate Muscle Building Growth Hormone In Humans Peptides Sermorelin CAS 86168-78-7 GRF 1-29
Contact Now

Cas No. 86168-78-7 Synonyms: Sermorelin Acetate Molecular Formula: C149H246N44O42S MW: 3357.88 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp... Read More Get Best Price

2018-12-19 09:48:03

Bodybuilding Supplements Growth Hormones For Adults AOD9604 CAS 221231-10-3
Contact Now

Cas No. 221231-10-3 Synonyms: AOD 9604 Molecular Formula: C78H123N23O23S2 MW: 1815.1 Sequence: Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe one disulfide bond. Purity: >98% Bacterial ... Read More Get Best Price

2018-12-19 09:48:03

Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass
Contact Now

Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSES... Read More Get Best Price

2018-12-19 09:58:01