Sermorelin Acetate Muscle Building Growth Hormone In Humans Peptides Sermorelin CAS 86168-78-7 GRF 1-29

Cas No. 86168-78-7

Synonyms: Sermorelin Acetate

Molecular Formula: C149H246N44O42S

MW: 3357.88

Sequence:

H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2

Purity: >98%

Bacterial Endotoxins: < 5EU/mg

Introduction:

Sermorelin, sometimes called GRF 1-29 NH2 with sequence

YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2, is an amidated synthetic 29-amino acid polypeptide that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It is used as a test for growth hormone secretion and often used extensively in anti-aging therapy in conjunction with testosterone in men.

Sermorelin, also known as GRF 1-29, is a synthetic peptide belonging to Hormone Releasing Hormone. Sermorelin Acetate is a truncated analog of a hormone releasing factor (GRF 1-44) that is naturally produced by the brain to stimulate pituitary production of human hormone.

Sermorelin works by promoting the secretion of Human Hormone from the pituitary gland. It stimulates the pituitary gland to naturally produce increased amounts of human hormone. The increased volume of human hormone produced by the pituitary gland causes an increase in the production of Insulin-Like Factor-1 (IGF-1) by the liver and results in the benefits of treatment provided to the adult patient.

Sermorelin is a 29-amino acid polypeptide representing the 1-29 fragment from endogenous human grow steroid releasing hormone, and is thought to be the shortest fully functional fragment of GHRH.Sermorelin is used as a test for grow steroid secretion. It is also used as doping substance in sports. Used extensively in Anti-aging Therapy often in conjunction with Test in men. Safer alternative to Human Grow steroid.

Application

Sermorelin promotes healthy function of the pituitary by binding to specific receptor to increase production and secretion of endogenous HGH. Pituitary is an endocrine gland located on the hypothalamus at the base of the brain. It secretes hormones that control growth, blood pressure, function of sex organs, thyroid glands, metabolism, pregnancy, childbirth, temperature and pain relief among others.

Sermorelin helps in the improvement of a wide variety of the body functions such as muscle mass, the bone mineral density and hence, muscle strength, exercise performance, the metabolic function, energy, libido and sexual performance, and even the improvement of quality life in general. An additional benefit in the use of Sermorelin is the stimulation of fat reduction.

This peptide can regulate the immune function, which is the protection process of an organism against diseases. This function detects any type of threats to start its self-defense and eliminate them.

Sermorelin can help in the prevention of joint deterioration and heart disease. People with arthritis can be benefited of positive results that this peptide brings in the regeneration of joint. Hearth disease is related to growth hormone deficiency but if this hormone is reestablished to its optimal levels, heart health can be improved.

Related products: