Jiangsu Biostronger Technology Co.,Ltd

 

HGH, Peptides, IGF-1 LR3, EGF, VEGF, Steroids And SARMs powder, Etc.
Sales & Support
Request A Quote - Email
Select Language
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home Products

HGH Human Growth Hormone

All Products
Synthetic Growth Hormone (29)
HGH Human Growth Hormone (14)
IGF Growth Hormone (10)
EGF Epidermal Growth Factor (15)
Cosmetic Peptides (12)
Weight Loss Growth Hormone (10)
Follistatin Myostatin (10)
Muscle Building Steroids (41)
Selective Androgen Receptor Modulators (12)
Bodybuilding Hormone Supplements (27)
Anti Estrogen Supplements (10)
Nootropic Supplements (10)
I'm Online Chat Now
Just completed an order with Peter and his service is A+++. I have posted it elsewhere on the board. I did a gh serum test with his gh and it comes back more 30, crazy high score for 10iu.

—— Ricky Rodrig from USA

Was and am VERY, VERY impressed with Peter. Superb communication and overall customer service!! A+++++. will definitely be doing business with you.

—— Trevor Maki from UK

Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass
Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass
HGH High Pure Human Growth Hormone Cas NO 12629-01-5 For Muscle Building
HGH High Pure Human Growth Hormone Cas NO 12629-01-5 For Muscle Building
Bodybuilding HGH Human Growth Hormone GHRP-6 Muscle Building Peptides CAS 87616-84-0
Bodybuilding HGH Human Growth Hormone GHRP-6 Muscle Building Peptides CAS 87616-84-0
Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5
Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5
CAS 158861 67 7 HGH Human Growth Hormone Peptides GHRP-2 Body Building
CAS 158861 67 7 HGH Human Growth Hormone Peptides GHRP-2 Body Building
1 2 3 4 5

HGH Human Growth Hormone

(14)
China Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass factory

Bodybuilding HGH Human Growth hormone CAS 12629 01 5 Synthetic Growth Hormone For Muscle Mass
Contact Now

Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: FPTIPLSRLFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSES... Read More Get Best Price
2018-12-19 09:58:01
China HGH High Pure Human Growth Hormone Cas NO 12629-01-5 For Muscle Building factory

HGH High Pure Human Growth Hormone Cas NO 12629-01-5 For Muscle Building
Contact Now

High Pure Human Growth Hormone Cas NO 12629-01-5 Muscle Building Cas No. 12629-01-5 Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White Powder Sequence: ... Read More Get Best Price
2019-09-02 15:38:37
China Bodybuilding HGH Human Growth Hormone GHRP-6 Muscle Building Peptides CAS 87616-84-0 factory

Bodybuilding HGH Human Growth Hormone GHRP-6 Muscle Building Peptides CAS 87616-84-0
Contact Now

Cas No. 87616-84-0 Synonyms: GHRP-6 Acetate Molecular Formula: C46H56N12O6 MW: 873.01 Sequence: H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: GHRP-6, a peptide with ... Read More Get Best Price
2018-12-19 09:58:01
China Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5 factory

Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5
Contact Now

Weight Loss Human Growth Hormone Muscle Gain Bodybuilding CAS 12629 01 5 Cas No. 12629-01-5 Size: 5iu/vial Synonyms: Human Growth Hormone Molecular Formula: CC990H1529N263O299S7 MW: 22124.12 Appearance: White ... Read More Get Best Price
2018-12-19 13:43:21
China CAS 158861 67 7 HGH Human Growth Hormone Peptides GHRP-2 Body Building factory

CAS 158861 67 7 HGH Human Growth Hormone Peptides GHRP-2 Body Building
Contact Now

Cas No. 158861-67-7 Synonyms: GHRP-2 Acetate Molecular Formula: C45H55N9O6 MW: 817.97 Sequence: H-D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Chemotherapy is ... Read More Get Best Price
2018-12-19 13:43:39
China Modified GRF 1-29 CJC-1295 HGH Synthetic Growth Hormone Muscle Gain CAS 863288-34-0 factory

Modified GRF 1-29 CJC-1295 HGH Synthetic Growth Hormone Muscle Gain CAS 863288-34-0
Contact Now

Modified GRF 1-29 CJC-1295 HGH Synthetic Growth Hormone Muscle Gain CAS 863288-34-0 Cas No. 863288-34-0 Synonyms: CJC-1295 without DAC, CJC 1295 w/o DAC Molecular Formula: C152H252N44O42 MW: 3367.97 Sequence: ... Read More Get Best Price
2018-12-19 09:58:01
China CAS 66004-57-7 HGH Human Growth Hormone Fragment 176-91 For Bodybuilding and Fat Loss factory

CAS 66004-57-7 HGH Human Growth Hormone Fragment 176-91 For Bodybuilding and Fat Loss
Contact Now

Cas No. 66004-57-7 Synonyms: HGH FRAG 176-191,fragment 176 Molecular Formula: C78H125N23O23S2 MW: 1817.1 Sequence: H-Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe-OH Purity: >98% Bacterial ... Read More Get Best Price
2018-12-19 09:58:01
China CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain factory

CAS 86168-78-7 GRF 1-29 Growth Hormone For Bodybuilding Sermorelin Acetate Muscle Gain
Contact Now

Cas No. 86168-78-7 Synonyms: Sermorelin Acetate Molecular Formula: C149H246N44O42S MW: 3357.88 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp... Read More Get Best Price
2018-12-19 13:43:45
China Ipamorelin Peptides HGH Human Growth Hormone CAS 170851 70 4 Growth Hormones For Adults factory

Ipamorelin Peptides HGH Human Growth Hormone CAS 170851 70 4 Growth Hormones For Adults
Contact Now

Cas No. 170851-70-4 Synonyms: Ipamorelin Molecular Formula: C38H49N9O5 MW: 711.85 Sequence: H-Aib-His-D-2-Nal-D-Phe-Lys-NH2 Purity: >98% Bacterial Endotoxins: < 5EU/mg Introduction: Ipamorelin, a pentapeptide ... Read More Get Best Price
2018-12-19 09:58:01
China MGF Mechano Growth Factor Peptide Human Growth Hormone Bodybuilding Growth Hormone factory

MGF Mechano Growth Factor Peptide Human Growth Hormone Bodybuilding Growth Hormone
Contact Now

Cas No. N/A Synonyms: MGF (Mechano Growth Factor) Molecular Formula: C121H200N42O39 MW: 2867.14 Sequence: H-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH2 ... Read More Get Best Price
2018-12-19 09:58:01
Page 1 of 2|< 1 2 >|
About Us
Synthetic Growth Hormone
HGH Human Growth Hormone
IGF Growth Hormone
Contact Us
Mobile Site
Privacy Policy | China Good Quality Synthetic Growth Hormone Supplier. © 2018 - 2023 synthetic-growthhormone.com. All Rights Reserved.